PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_17467-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bHLH
Protein Properties Length: 332aa    MW: 36226.3 Da    PI: 5.4048
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_17467-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH28.92.1e-09203232130
                      CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC CS
              HLH   1 rrrahnerErrRRdriNsafeeLrellPka 30 
                      +r++h ++Er+RR+++N+ +  Lr+l+P +
  TRIUR3_17467-P1 203 QRMTHIAVERNRRRQMNDYLRVLRSLMPGS 232
                      79**************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474592.04E-8195233IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000835.04E-8201248No hitNo description
Gene3DG3DSA:4.10.280.103.1E-8201238IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.817202256IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000108.4E-7203232IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010377Biological Processguard cell fate commitment
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0005634Cellular Componentnucleus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MADQFRMCLL VTMRGRSEQG SSHQLDTFAQ LDGGAAPEEP IGGGAAAEMV DYMLGQTTPL  60
PPGGPHGQVS LDKLSFSDVL QFADFGPRLA LNQPSAADHA DARDDDEEDS YFFRFQSQLS  120
GSDDPDPRGG AGIHHAAEHE GSKTADGSGG PHDHGGGVSE STTLVQQSDG GGRVGQKAGG  180
EQAKSGRRKR PRSTKTSEEV ESQRMTHIAV ERNRRRQMND YLRVLRSLMP GSYVQREVAE  240
NKSSLADIEV RVLGEDAVIK VLSRRRPEQL IKTIAVLEEM HMSILHTNIT TIEQTVLYSF  300
NVKITSEPRF TAEEIVGAVH QILSFIDVNY TL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203214RMTHIAVERNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2521090.0AK252109.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf148l20, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961059.11e-77PREDICTED: transcription factor FAMA
SwissprotQ56YJ86e-41FAMA_ARATH; Transcription factor FAMA
TrEMBLM7ZJ690.0M7ZJ69_TRIUA; Transcription factor FAMA
STRINGMLOC_60291.11e-129(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP95023340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24140.12e-42bHLH family protein